DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7339 and AT1G06790

DIOPT Version :9

Sequence 1:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_172164.1 Gene:AT1G06790 / 837190 AraportID:AT1G06790 Length:204 Species:Arabidopsis thaliana


Alignment Length:231 Identity:80/231 - (34%)
Similarity:119/231 - (51%) Gaps:32/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65
            ||.|:||:.::|:.|...:|.|.||::..:.....:|||.::|||:::.||.|::...:||||||
plant     1 MFYLSELEHSLRVPPHLLNLPLEDAIKSVLQNVFLDKVLADLGLCVSIYDIKSVEGGFVLPGDGA 65

  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSR-----FDEAEQ 125
            :..:|..|.|||||.||.||..|.:.....|:.:||||||||.:|...:..|:|     ::..:.
plant    66 ATYKVGLRIVVFRPFVGEVIAAKFKESDANGLRLTLGFFDDIYVPAPLMPKPNRCEPDPYNRKQM 130

  Fly   126 AWVWEYPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQE 190
            .|||||   ...|.|..:|....|||||        ..|..|....:..:.|...|         
plant   131 IWVWEY---GEPKEDYIVDDACQIKFRV--------ESISYPSVPTERAEDAKPFA--------- 175

  Fly   191 VKTPYRIIGAINESGLGVLSWWDQQGKDDEQDDEED 226
               |..:.|.:::.|||.:||||..    ||.|:|:
plant   176 ---PMVVTGNMDDDGLGPVSWWDSY----EQVDQEE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 73/215 (34%)
RNAP_III_Rpc25_N 2..81 CDD:239822 32/78 (41%)
RNA_pol_Rbc25 79..212 CDD:285491 41/137 (30%)
AT1G06790NP_172164.1 RPB7 1..194 CDD:224020 73/215 (34%)
RNAP_III_Rpc25_N 2..81 CDD:239822 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3531
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6337
Inparanoid 1 1.050 135 1.000 Inparanoid score I1835
OMA 1 1.010 - - QHG54252
OrthoDB 1 1.010 - - D1430056at2759
OrthoFinder 1 1.000 - - FOG0004963
OrthoInspector 1 1.000 - - oto3161
orthoMCL 1 0.900 - - OOG6_101831
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.