DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7339 and polr3h

DIOPT Version :9

Sequence 1:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001072397.1 Gene:polr3h / 779851 XenbaseID:XB-GENE-951194 Length:207 Species:Xenopus tropicalis


Alignment Length:212 Identity:124/212 - (58%)
Similarity:157/212 - (74%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65
            ||||.|:.|.||..|.||..||.|::.:|:::||||||:.||||||.|.||..:.||.|.|||||
 Frog     1 MFVLVEMVDTVRTNPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKMDDSYIFPGDGA 65

  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWE 130
            |||:|.||||||||.:..::.|||:.||.|||||:|||||||:||..:||.|::||||||.||||
 Frog    66 SHTKVQFRYVVFRPFLDEILMGKIKGCSPEGVHVSLGFFDDIVIPPESLQQPAKFDEAEQVWVWE 130

  Fly   131 YPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQEVKTPY 195
            |..|:|| |||:|||||.|:||:..|.|.:|||.||...|      ||:|.|||..|.:: :.||
 Frog   131 YETEEGA-HDLYMDVGEDIRFRMVDETFIDTSPTGPSSAE------ASSSTAVAEETPRK-EAPY 187

  Fly   196 RIIGAINESGLGVLSWW 212
            .::|:|:|.|||:||||
 Frog   188 TLVGSISEPGLGLLSWW 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 122/210 (58%)
RNAP_III_Rpc25_N 2..81 CDD:239822 49/78 (63%)
RNA_pol_Rbc25 79..212 CDD:285491 73/132 (55%)
polr3hNP_001072397.1 RNAP_III_Rpc25_N 2..81 CDD:239822 49/78 (63%)
RNA_pol_Rbc25 79..204 CDD:369797 73/132 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4201
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6337
Inparanoid 1 1.050 250 1.000 Inparanoid score I3159
OMA 1 1.010 - - QHG54252
OrthoDB 1 1.010 - - D1430056at2759
OrthoFinder 1 1.000 - - FOG0004963
OrthoInspector 1 1.000 - - oto102467
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1195
SonicParanoid 1 1.000 - - X3501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.