DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7339 and polr3h

DIOPT Version :9

Sequence 1:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001002476.1 Gene:polr3h / 436749 ZFINID:ZDB-GENE-040718-179 Length:214 Species:Danio rerio


Alignment Length:214 Identity:121/214 - (56%)
Similarity:157/214 - (73%) Gaps:2/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65
            ||||.|::|.|||.|..|...|.:||.:|:::||||||:.||||||.|.||..|:||.|.|||||
Zfish     1 MFVLVEMRDTVRIPPWSFQRPLNEAVAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGA 65

  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWE 130
            |||:|.||||||.|.:..::.|||:.||.|||||:||||||||||..:||.|::||||||.||||
Zfish    66 SHTKVHFRYVVFHPFLDEILLGKIKGCSAEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWE 130

  Fly   131 YPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGP-PKTEAQTQQGASTSAAVASATSQEVKTP 194
            |..::|. |||:||.||.|:|||:.|:|.:|||.|| ...||.....|:...|.|...:|:.::|
Zfish   131 YETDEGT-HDLYMDQGEEIRFRVTDEVFVDTSPSGPSADKEAPGTGAAAAPPAGAEDAAQQKESP 194

  Fly   195 YRIIGAINESGLGVLSWWD 213
            |.:||:::|.|||:||||:
Zfish   195 YTLIGSVSEPGLGLLSWWN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 119/211 (56%)
RNAP_III_Rpc25_N 2..81 CDD:239822 49/78 (63%)
RNA_pol_Rbc25 79..212 CDD:285491 70/133 (53%)
polr3hNP_001002476.1 RPB7 1..212 CDD:224020 119/211 (56%)
RNAP_III_Rpc25_N 2..81 CDD:239822 49/78 (63%)
RNA_pol_Rbc25 79..212 CDD:285491 70/133 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580397
Domainoid 1 1.000 155 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6337
Inparanoid 1 1.050 250 1.000 Inparanoid score I3223
OMA 1 1.010 - - QHG54252
OrthoDB 1 1.010 - - D1430056at2759
OrthoFinder 1 1.000 - - FOG0004963
OrthoInspector 1 1.000 - - oto41172
orthoMCL 1 0.900 - - OOG6_101831
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.