DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7339 and Polr3h

DIOPT Version :9

Sequence 1:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001120767.1 Gene:Polr3h / 300088 RGDID:1305889 Length:204 Species:Rattus norvegicus


Alignment Length:215 Identity:121/215 - (56%)
Similarity:157/215 - (73%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65
            ||||.|:.|.|||.|.||..||.|::.:|:::||||||:.||||||.|.||..|:|:.:.|||||
  Rat     1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGA 65

  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWE 130
            |||:|.||||||.|.:..::.|||:.||.|||||:||||||||||..:||.|::||||||.||||
  Rat    66 SHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWE 130

  Fly   131 YPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQEV---K 192
            |..|:|| |||:||.||.|:|||..|.|.:|||.||             |:|.|:::|:|:   :
  Rat   131 YETEEGA-HDLYMDTGEEIRFRVVDESFVDTSPTGP-------------SSAEAASSSEELPKKE 181

  Fly   193 TPYRIIGAINESGLGVLSWW 212
            .||.::|:|:|.|||:||||
  Rat   182 APYTLVGSISEPGLGLLSWW 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 119/213 (56%)
RNAP_III_Rpc25_N 2..81 CDD:239822 48/78 (62%)
RNA_pol_Rbc25 79..212 CDD:285491 71/135 (53%)
Polr3hNP_001120767.1 RNAP_III_Rpc25_N 2..81 CDD:239822 48/78 (62%)
RNA_pol_Rbc25 83..201 CDD:400543 70/131 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340598
Domainoid 1 1.000 149 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6337
Inparanoid 1 1.050 244 1.000 Inparanoid score I3213
OMA 1 1.010 - - QHG54252
OrthoDB 1 1.010 - - D1430056at2759
OrthoFinder 1 1.000 - - FOG0004963
OrthoInspector 1 1.000 - - oto95729
orthoMCL 1 0.900 - - OOG6_101831
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.