DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7339 and rpc25

DIOPT Version :9

Sequence 1:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001342773.1 Gene:rpc25 / 2540510 PomBaseID:SPBC2G5.07c Length:203 Species:Schizosaccharomyces pombe


Alignment Length:213 Identity:80/213 - (37%)
Similarity:124/213 - (58%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65
            ||:|:...|.:.|.|..|.....:|:.:||.:|.||||:.|:||.|.:.|.:.:.:.||..|||:
pombe     1 MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGS 65

  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWE 130
            |:..|:||.::|||..|.|:.|||::||.||:.||:.|||||.||...|..|..|...|:||||:
pombe    66 SYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWK 130

  Fly   131 YPLEDGAK-HDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQEVKTP 194
            ...|||:: .:|:.|:.|.|:|::..|.|.:.||           :....:.|:....:.|..:|
pombe   131 IEGEDGSEGTELYFDIDEEIRFQIESEDFVDISP-----------KRNKNATAITGTEALESVSP 184

  Fly   195 YRIIGAINESGLGVLSWW 212
            |.:|.:.:..|||:.:||
pombe   185 YTLIASCSRDGLGIPAWW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 78/211 (37%)
RNAP_III_Rpc25_N 2..81 CDD:239822 31/78 (40%)
RNA_pol_Rbc25 79..212 CDD:285491 47/133 (35%)
rpc25NP_001342773.1 RPB7 1..193 CDD:224020 75/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1905
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6337
Inparanoid 1 1.050 159 1.000 Inparanoid score I1257
OMA 1 1.010 - - QHG54252
OrthoFinder 1 1.000 - - FOG0004963
OrthoInspector 1 1.000 - - oto100556
orthoMCL 1 0.900 - - OOG6_101831
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1195
SonicParanoid 1 1.000 - - X3501
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.