DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7339 and POLR3H

DIOPT Version :9

Sequence 1:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001018060.1 Gene:POLR3H / 171568 HGNCID:30349 Length:204 Species:Homo sapiens


Alignment Length:215 Identity:120/215 - (55%)
Similarity:155/215 - (72%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65
            ||||.|:.|.|||.|.||..||.|::.:|:::||||||:.||||||.|.||..|:|:.:.|||||
Human     1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGA 65

  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWE 130
            |||:|.||.|||.|.:..::.|||:.||.|||||:||||||||||..:||.|::||||||.||||
Human    66 SHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWE 130

  Fly   131 YPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQEV---K 192
            |..|:|| |||:||.||.|:|||..|.|.:|||.||             |:|.|:.:|:|:   :
Human   131 YETEEGA-HDLYMDTGEEIRFRVVDESFVDTSPTGP-------------SSADATTSSEELPKKE 181

  Fly   193 TPYRIIGAINESGLGVLSWW 212
            .||.::|:|:|.|||:||||
Human   182 APYTLVGSISEPGLGLLSWW 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 118/213 (55%)
RNAP_III_Rpc25_N 2..81 CDD:239822 47/78 (60%)
RNA_pol_Rbc25 79..212 CDD:285491 71/135 (53%)
POLR3HNP_001018060.1 RNAP_III_Rpc25_N 2..81 CDD:239822 47/78 (60%)
RNA_pol_Rbc25 83..201 CDD:400543 70/131 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..179 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146937
Domainoid 1 1.000 148 1.000 Domainoid score I4506
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6337
Inparanoid 1 1.050 240 1.000 Inparanoid score I3353
Isobase 1 0.950 - 0 Normalized mean entropy S661
OMA 1 1.010 - - QHG54252
OrthoDB 1 1.010 - - D1430056at2759
OrthoFinder 1 1.000 - - FOG0004963
OrthoInspector 1 1.000 - - oto88597
orthoMCL 1 0.900 - - OOG6_101831
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1195
SonicParanoid 1 1.000 - - X3501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.