DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIOK1 and RIOK3

DIOPT Version :9

Sequence 1:NP_648489.1 Gene:RIOK1 / 39309 FlyBaseID:FBgn0036187 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_003822.2 Gene:RIOK3 / 8780 HGNCID:11451 Length:519 Species:Homo sapiens


Alignment Length:462 Identity:159/462 - (34%)
Similarity:249/462 - (53%) Gaps:82/462 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DAEEDEEDLRSSEWTNDFKNLTLKHEIFKDIKLTPKEDCDDLAQVIATANEEDEPEDEEPEEYDE 74
            |.|.|.:..|..:..|....:::..|.::  |:.|.||.|                    ...||
Human    89 DREYDAQLRREEKKFNGDSKVSISFENYR--KVHPYEDSD--------------------SSEDE 131

  Fly    75 DDYDDIGDDYDTYEEAYTGFNKLHVQPQLTNASGGGSGGGAGGASGGSQRVSSYQPNEKLLRRYS 139
            .|:.|..|  |.|..|         :|..|...         |..|..:.:::........|:.:
Human   132 VDWQDTRD--DPYRPA---------KPVPTPKK---------GFIGKGKDITTKHDEVVCGRKNT 176

  Fly   140 ARINVEKYDPT------TNMSAQAANRLVN-------FDRRDRTQVRDKHDRATAEQVMDPRTRM 191
            ||  :|.:.|.      ..|..:.:|.:.|       .:.|...::.:|.:.:|||:.:||:||:
Human   177 AR--MENFAPEFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRL 239

  Fly   192 ILFKLLNRGMIQEINGCISTGKEANVYHAVSKNGEE----------EFAIKIYKTSILVFKDRDK 246
            :::|::|.||::.|.||||||||:.|:||...:.|:          |.|||::||::..||:|||
Human   240 LMYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDK 304

  Fly   247 YVSGEFRFRHGYCKHNPRKMVRTWAEKEMRNYLRMRNAGVPVPEPILLRSHVLVMRFCGRDGWPA 311
            |:..:|||:..:.|.||||::|.||||||.|..||:.||:|.|..:||:.|:|||.|.|.|..||
Human   305 YIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPA 369

  Fly   312 PKLKDVELSTSKARELYRDCVVIMWRIYNQCRLVHADLSEFNILLQDGQLVIIDVSQSVEHDHPH 376
            ||||:|:|::.:.:|.|...:.:|.::|::|.||||||||:|:|...|::.:||||||||..|||
Human   370 PKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPH 434

  Fly   377 SFDFLRKDCTNISEFFRKRAV-ATMTVKELFDFITDQTITTENMEECLERISERIKDRDFDA-IS 439
            ..:||.:||.|:|:||:|..| ..::.:|||:.::...||.:|             :.||.| |.
Human   435 GLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADN-------------EADFLAEIE 486

  Fly   440 AQEKIDE 446
            |.||::|
Human   487 ALEKMNE 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIOK1NP_648489.1 RIO1 164..420 CDD:224632 120/266 (45%)
RIO1_euk 205..395 CDD:270698 99/199 (50%)
RIOK3NP_003822.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..159 16/77 (21%)
RIO1 214..465 CDD:224632 115/250 (46%)
RIO3_euk 253..453 CDD:270697 99/199 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1718
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.