DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIOK1 and Riok3

DIOPT Version :9

Sequence 1:NP_648489.1 Gene:RIOK1 / 39309 FlyBaseID:FBgn0036187 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001101893.1 Gene:Riok3 / 361293 RGDID:1310833 Length:519 Species:Rattus norvegicus


Alignment Length:462 Identity:158/462 - (34%)
Similarity:247/462 - (53%) Gaps:82/462 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DAEEDEEDLRSSEWTNDFKNLTLKHEIFKDIKLTPKEDCDDLAQVIATANEEDEPEDEEPEEYDE 74
            |.|.|.:..|..:..|....:::..|.::  |:.|.||.|                    ...||
  Rat    89 DREYDAQLRREEKKFNGDSKVSISFENYR--KVHPFEDSD--------------------SSEDE 131

  Fly    75 DDYDDIGDDYDTYEEAYTGFNKLHVQPQLTNASGGGSGGGAGGASGGSQRVSSYQPNEKLLRRYS 139
            .|:.|..|  |.|..|         :|..|...         |..|..:.:::........|:.:
  Rat   132 VDWQDTRD--DPYRPA---------KPVPTPKK---------GFIGKGKDITTKHDEVVCGRKNT 176

  Fly   140 ARINVEKYDP------TTNMSAQAANRLVN-------FDRRDRTQVRDKHDRATAEQVMDPRTRM 191
            ||  :|.:.|      ...|..:.:|.:.|       .:.|...::.:|.:.:|||:.:||:||:
  Rat   177 AR--MENFAPGFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRL 239

  Fly   192 ILFKLLNRGMIQEINGCISTGKEANVYHAVSKNGEE----------EFAIKIYKTSILVFKDRDK 246
            :::|::|.||::.|.||||||||:.|:||...:.|:          |.|||::||::..||:|||
  Rat   240 LMYKMVNSGMLETITGCISTGKESVVFHAYGGSLEDEKEDGKVIPTECAIKVFKTTLNEFKNRDK 304

  Fly   247 YVSGEFRFRHGYCKHNPRKMVRTWAEKEMRNYLRMRNAGVPVPEPILLRSHVLVMRFCGRDGWPA 311
            |:..:|||:..:.|.||||::|.||||||.|..||:.||:|.|..:||:.|:|||.|.|.|..||
  Rat   305 YIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLTRMQKAGIPCPTVVLLKKHILVMSFIGHDQVPA 369

  Fly   312 PKLKDVELSTSKARELYRDCVVIMWRIYNQCRLVHADLSEFNILLQDGQLVIIDVSQSVEHDHPH 376
            ||||:|:||..:.::.|...:.:|.::|.:|.||||||||:|:|...|::.:||||||||..|||
  Rat   370 PKLKEVKLSEEEMKDAYHQTLHLMQQLYKECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPH 434

  Fly   377 SFDFLRKDCTNISEFFRKRAV-ATMTVKELFDFITDQTITTENMEECLERISERIKDRDFDA-IS 439
            ..:||.:||.|:|:||:|..| ..:..:|||:.::..:|:.:|             :.||.| |.
  Rat   435 GLEFLFRDCRNVSQFFQKGGVKEALNERELFNAVSGLSISADN-------------EADFLAEIE 486

  Fly   440 AQEKIDE 446
            |.||::|
  Rat   487 ALEKMNE 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIOK1NP_648489.1 RIO1 164..420 CDD:224632 119/266 (45%)
RIO1_euk 205..395 CDD:270698 99/199 (50%)
Riok3NP_001101893.1 RIO1 214..461 CDD:224632 114/246 (46%)
RIO3_euk 253..453 CDD:270697 99/199 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1718
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.