DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and TAF2

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_177536.2 Gene:TAF2 / 843733 AraportID:AT1G73960 Length:1390 Species:Arabidopsis thaliana


Alignment Length:653 Identity:139/653 - (21%)
Similarity:237/653 - (36%) Gaps:122/653 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GIVSIDIEATQPTRVIYL----NSLNITISRQRTW--IYRWASGRKIGALQIKRIIKKTSLIKIV 104
            ||.|:.::. :||...|.    ||     ..:..|  :...||.....|::...::|:.....::
plant    65 GIESVLVDG-EPTVFEYYPHHQNS-----ETESNWNSVSDPASAADAAAMEYVGVLKREDTANLL 123

  Fly   105 IELPLRSGEIYTLNMLFSGNLDRSQQYGYFAGYYDKTPRVFYSATRLEP------DYAHT----- 158
            |.....|.::  ...|.|..|:...|....|....|..|:.|...::|.      :..||     
plant   124 INCCKPSKDL--SEQLDSVTLENGSQSSGEAKQNVKLIRINYWVEKIESGIHFDGNIVHTDNQMR 186

  Fly   159 ----VFPCFDDPRFRTPYNITLVHDRKYVALSNMPPVEEKPYKEIENYVSTTFMGSPPLATQQVM 219
                .|||.||...|..:::.......:||:|....:.:...||.....:..:..:.|:|.:.|.
plant   187 RARCWFPCIDDEYHRCSFDLEFTVPHNFVAVSVGKLLYQVMCKEDTTQKTYVYELAIPIAPRWVS 251

  Fly   220 WTLHQLEKVYSGPAAAGENITVWSRPHLAEKLAKVPEMTPNLFSKYETLFAYPLPKGADWGGKVD 284
            .....||.:   |......|:....||...:|....|.....:|.||...:...|.|.     ..
plant   252 LVAGPLEIL---PDQTNFLISNLCLPHDLSRLRNTMEFFHEAYSYYEDYLSANFPFGF-----YK 308

  Fly   285 HVVLPR---YTEMYSGQGI------MVYGEDIVDSGQNGLESLQETLAELVARQWNGLLVNLEDS 340
            .|.||.   .|...||..:      ::|.|.::|.    ....:..||..:|:||.|:.:..|..
plant   309 QVFLPPEMVVTSSTSGASLSIFSSHILYDERVIDQ----TIDTRIKLASALAKQWFGVYITPESP 369

  Fly   341 DEEYVRNGINYYLS----VQVMAMDKEAYN--TTHLSKTRLDVLYHDSLAKVKSIATDVKE---- 395
            :::::.:|:..:|:    .|.:..::..|.  ..:.:..:.|    ||.|...|.:...::    
plant   370 NDDWLLDGLAGFLTDMFIKQFLGNNEARYRRYKANCAVCKAD----DSGAMCLSSSPSCRDLFGT 430

  Fly   396 ---SGHQKLRKKKMCLLIHMLKVALGDKLFLKGLQEFFKRYANSSASSKEL-WEEFQRGARRSHQ 456
               ..|.|:|..|...::.||:..:|...|.|.||:...|..:.|.|.:.| .:||::.|.:...
plant   431 HSIGMHGKIRSWKSGAVLQMLEKQMGSDSFRKILQKIISRAKDPSNSIRSLSTKEFRQFANKIGN 495

  Fly   457 LPTGVSLPTVMESWMKQPGFPLLTVQRDDAKQIVTITQSRYYQKYLDNSSNDCWWVPVAYIVRNL 521
            |.... |....:.|:...|.|:|.:             ...|.|..:|                 
plant   496 LERPF-LKEFFQRWVASYGCPVLRI-------------GLSYNKRKNN----------------- 529

  Fly   522 TLPQVEWLGCQKNSRDI-LELSHIANPEDWLLINVDAAVP----LRVFYDSYNLQLISE----AL 577
                ||....::.:..: ..||.|....|....:|||..|    :||    |.|..:|:    .:
plant   530 ----VEMAALRECTAALDARLSVIGATSDSESRDVDAGWPGIMSIRV----YELDGMSDHPKLPM 586

  Fly   578 RQDFTQIPEL-SRIQLVDDALSLSWSGRLPYNVTLNV--ISYLSNETSV---LVWETALLNLEKL 636
            ..|..|:.|| ...:|..........|..|.....||  |:.|.|:||:   |.|..|...:|.:
plant   587 AGDRWQLLELPCHSKLAAKRYQKPKKGGKPDGAEDNVDAIAPLENKTSIESPLAWIKADPEMEYI 651

  Fly   637 QSI 639
            ..|
plant   652 AEI 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352 100/474 (21%)
ERAP1_C 551..929 CDD:288671 28/103 (27%)
TAF2NP_177536.2 M1_TAF2 24..527 CDD:189018 104/499 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.