DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and Rpl24

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_077180.1 Gene:Rpl24 / 68193 MGIID:1915443 Length:157 Species:Mus musculus


Alignment Length:55 Identity:14/55 - (25%)
Similarity:26/55 - (47%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 RYANSSASSKELWEEFQRGARRSHQLPTGVSLPTVMESWMKQPGFPLLTVQRDDA 486
            |..:....|:|:.::..|.|.:..:..||.||..:|....::|  .:...||:.|
Mouse    56 RRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKP--EVRKAQREQA 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352 11/44 (25%)
ERAP1_C 551..929 CDD:288671
Rpl24NP_077180.1 Ribosomal_L24e 2..64 CDD:395998 1/7 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..157 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.