DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and zmpste24

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001017255.1 Gene:zmpste24 / 550009 XenbaseID:XB-GENE-954285 Length:466 Species:Xenopus tropicalis


Alignment Length:154 Identity:34/154 - (22%)
Similarity:57/154 - (37%) Gaps:50/154 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   817 ILLNSLSCTTEYWAMQKLLSW---------ALDSKKVPRTMT----------------ASLLSAV 856
            ::|:.:|..::.:....|.||         |...:|:.||.|                .|.|..:
 Frog     3 LMLSEMSVESQIFYSVLLFSWIVYTWEAYLASRQRKIYRTTTHVPAELGNIMDAETFEKSRLYQL 67

  Fly   857 LRSPLGYYVGKQFLIDHSKEILRSKDVKLIL----TPFI----NAMSTKAEFSALNDHLHRNLPS 913
            .:|...::.|          :....:..|||    .||:    ..|..:|.|||..:.:|     
 Frog    68 DKSTFSFWSG----------LYSEAEGTLILLLGGIPFLWNIAEQMLYRAGFSAEYEIIH----- 117

  Fly   914 SMVSGLSSTLESGLDRVNWRNNLY 937
            |:|..|.:||.|....:.|  :||
 Frog   118 SLVFLLLATLFSAFTGLPW--SLY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352
ERAP1_C 551..929 CDD:288671 31/144 (22%)
zmpste24NP_001017255.1 M48A_Zmpste24p_like 16..461 CDD:320702 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.