DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and wdr33

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001362197.1 Gene:wdr33 / 548794 XenbaseID:XB-GENE-6083684 Length:1598 Species:Xenopus tropicalis


Alignment Length:125 Identity:31/125 - (24%)
Similarity:51/125 - (40%) Gaps:35/125 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 EALRQDFTQIPELSRIQLVDDALSLSWSGR----------LPYNVTLNVISYLSNETSVLVWETA 629
            :|.||.|.:.|:.::.|.:.   .|::.|:          :.||.  :||.||.|.    ||:..
 Frog    20 QAPRQLFYKRPDYAQQQAMQ---QLTFDGKRMRKAVNRKTIDYNP--SVIKYLENR----VWQRD 75

  Fly   630 LLNLEKLQSIMRMTTGFRIFKLYMQKLIEP--AFKTTLNSLSTK-ARTGSEIPINTKSPV 686
            ..::..:|.    ..|      |...|:.|  .....||:::|| .||.:.   ..|.||
 Frog    76 QRDMRAIQP----DAG------YYNDLVPPIGMINNPLNAVTTKFVRTSTN---KVKCPV 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352
ERAP1_C 551..929 CDD:288671 31/125 (25%)
wdr33NP_001362197.1 WD40 121..402 CDD:238121 2/2 (100%)
WD40 repeat 122..159 CDD:293791 1/1 (100%)
WD40 repeat 165..200 CDD:293791
WD40 repeat 205..241 CDD:293791
WD40 repeat 248..285 CDD:293791
WD40 repeat 291..328 CDD:293791
WD40 repeat 336..372 CDD:293791
WD40 repeat 378..402 CDD:293791
PAT1 <479..>646 CDD:370676
Med15 566..>973 CDD:312941
Med15 905..>1265 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.