DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and vezf1

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001006865.1 Gene:vezf1 / 448632 XenbaseID:XB-GENE-481523 Length:512 Species:Xenopus tropicalis


Alignment Length:85 Identity:25/85 - (29%)
Similarity:34/85 - (40%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 TLNSLSTKARTGSEIPINTKSPVTTES----SGTTESPDTTESPDTAESPDTTESSNTTESPDTT 724
            |.|...|.  |.|:.|:...||....|    |||..:|.|..:..:..||....|.....||...
 Frog   371 TSNLCQTS--TTSQTPVTLTSPFNITSSVAASGTLTNPVTVAAAMSMRSPVNVSSPVNITSPMNL 433

  Fly   725 ESSDTTESPDTTKSDLSLSA 744
            ....|..:|.:..|.|||::
 Frog   434 GHPVTITTPISMTSPLSLTS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352
ERAP1_C 551..929 CDD:288671 25/85 (29%)
vezf1NP_001006865.1 C2H2 Zn finger 83..103 CDD:275368
C2H2 Zn finger 184..204 CDD:275368
SFP1 <206..263 CDD:227516
C2H2 Zn finger 212..232 CDD:275368
C2H2 Zn finger 242..260 CDD:275368
C2H2 Zn finger 271..291 CDD:275368
Atrophin-1 372..>510 CDD:367360 24/84 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.