Sequence 1: | NP_648488.1 | Gene: | CG6071 / 39308 | FlyBaseID: | FBgn0036186 | Length: | 962 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507368.2 | Gene: | Y68A4B.3 / 190532 | WormBaseID: | WBGene00013472 | Length: | 217 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 43/195 - (22%) |
---|---|---|---|
Similarity: | 68/195 - (34%) | Gaps: | 59/195 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 668 LSTKARTGSEIPINTKSPVTTESSGTTESPDTTESPDTAESPDTTESSNTTESPDTTESSDTTES 732
Fly 733 PDTTKSDLSLSAI--------------LYRL-----------------------ACQFEIKECLT 760
Fly 761 DAQQRFQAAMDQKSSSSIPEEIREIVLCRGIRNGLEVHWIMVRDMFFESENDKERSIL-LNSLSC 824
Fly 825 824 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6071 | NP_648488.1 | GluZincin | 25..477 | CDD:301352 | |
ERAP1_C | 551..929 | CDD:288671 | 43/195 (22%) | ||
Y68A4B.3 | NP_507368.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |