DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and Y68A4B.3

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_507368.2 Gene:Y68A4B.3 / 190532 WormBaseID:WBGene00013472 Length:217 Species:Caenorhabditis elegans


Alignment Length:195 Identity:43/195 - (22%)
Similarity:68/195 - (34%) Gaps:59/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 LSTKARTGSEIPINTKSPVTTESSGTTESPDTTESPDTAESPDTTESSNTTESPDTTESSDTTES 732
            ::||..||...|.....|..||:..||.:..||..|.|.|...||.::.||.:  ||.::.|||:
 Worm    39 ITTKEPTGPGSPGAPGGPRATEAPITTTAITTTTEPLTEEPTSTTTTTTTTTT--TTTTTTTTEA 101

  Fly   733 PDTTKSDLSLSAI--------------LYRL-----------------------ACQFEIKECLT 760
            |....||...:||              |::.                       .|:|.......
 Worm   102 PGPMPSDCDPNAICDINAISPTYTAPYLFKTMPRMLDKDGCPTVEITCTKQVVGTCKFSFIAVNA 166

  Fly   761 DAQQRFQAAMDQKSSSSIPEEIREIVLCRGIRNGLEVHWIMVRDMFFESENDKERSIL-LNSLSC 824
            |.:      ...|.:.::...:...|.||             :|..|..::|.:.:|. |..:.|
 Worm   167 DGE------TPVKGAQTVANTVGYSVTCR-------------KDGTFSMKDDNKNNIFGLTGIKC 212

  Fly   825  824
             Worm   213  212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352
ERAP1_C 551..929 CDD:288671 43/195 (22%)
Y68A4B.3NP_507368.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.