DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and corin

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_004911266.2 Gene:corin / 100492163 XenbaseID:XB-GENE-950958 Length:1123 Species:Xenopus tropicalis


Alignment Length:335 Identity:62/335 - (18%)
Similarity:123/335 - (36%) Gaps:57/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 DALSLSWSGRLPYNVTL--NVISYLSNETSVLVWETALLNLEKLQSIMRMTTGFRIFKLYMQKLI 657
            :.::|.....||||.|.  |.:.:.:.:.:.:.||::|.      ..:..|..::....:...::
 Frog   535 EPITLELCINLPYNYTTFPNYLGHRTQKEASISWESSLF------PALVQTNCYKYLMYFACTIL 593

  Fly   658 EPAFKTTLNSLSTKARTGSEIPINTKSPVTTESSGTTESPDTTESPDTAESPDTTESSNTTESPD 722
            .|         ..:..|...||     |..:....:.|..::.......:.|:.|:   .|:.||
 Frog   594 VP---------KCEPETHQRIP-----PCRSLCEHSKERCESVLGIVGLQWPEDTD---CTQFPD 641

  Fly   723 TTESSDTTESPDTTKSDLSLSAILYRLA-CQFEIKECLTDAQQRFQAAMDQKSSSSIPEEIREIV 786
            ....:.|...||....:.|.|....|.. |....:.|  |.:...:...|:::.......:.|..
 Frog   642 EKSDNQTCLMPDEDVEECSPSHYKCRSGRCILASRRC--DGEADCEDDSDEENCECAERGLWECP 704

  Fly   787 LCRGIRNGLEVHWIMVRDMFFESENDKERSILLNSLSCTTE--YWAMQKLLS---WA---LDSK- 842
            :     |.:.:...|:.|.|.:...:.|..   |..|||:|  ..|..:.:|   |.   :|.. 
 Frog   705 V-----NKMCIKHSMICDGFPDCPEELEEK---NCSSCTSEELECANHECVSRDRWCDGLIDCTD 761

  Fly   843 --------KVPRTMTASLLSAVLRSPLGYYVGKQFLIDHSKEILRSKDVKLIL-TPFINAMSTKA 898
                    .:.:::::.....:.||...|:|...   |..:|:.:....:|.| .|.|.|.:|:.
 Frog   762 GSDEWNCVTLSKSVSSLTFLTIHRSASDYHVCAD---DWEEELTQWVCNQLGLGGPSITAEATEL 823

  Fly   899 EFSALNDHLH 908
            :....|:.||
 Frog   824 DHFGHNEWLH 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352
ERAP1_C 551..929 CDD:288671 62/335 (19%)
corinXP_004911266.2 CRD_corin_1 213..341 CDD:143554
LDLa 351..382 CDD:238060
LDLa 384..418 CDD:238060
LDLa 420..455 CDD:238060
LDLa 465..492 CDD:238060
CRD_corin_2 533..654 CDD:143579 24/141 (17%)
LDLa 659..693 CDD:238060 7/35 (20%)
LDLa 734..768 CDD:238060 7/33 (21%)
Tryp_SPc 883..1114 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165173363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.