DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6071 and pip4k2a

DIOPT Version :9

Sequence 1:NP_648488.1 Gene:CG6071 / 39308 FlyBaseID:FBgn0036186 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001123723.1 Gene:pip4k2a / 100170468 XenbaseID:XB-GENE-962635 Length:405 Species:Xenopus tropicalis


Alignment Length:285 Identity:60/285 - (21%)
Similarity:108/285 - (37%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 VRNGINYYLSVQVMAM----DKEAYNTTHLSKTRLD-VLYHDSLAKVKSIATDVKESGHQKLRKK 404
            |.:.||....||:..|    |.:||     ||.::| .|::             ||:.....:.|
 Frog    44 VNHSINELSHVQIPIMLMPDDFKAY-----SKIKVDNHLFN-------------KENMPSHFKFK 90

  Fly   405 KMC-LLIHMLKVALG--DKLFLKGLQEFF-------------------KRYANSSASSKELWEEF 447
            :.| ::...|:...|  |:.||..|..:.                   |||...:.:|::: .|.
 Frog    91 EYCPMVFRNLRERFGIDDQDFLNSLTRYSPLANDSQARSGARFHTSCDKRYIIKTITSEDV-AEM 154

  Fly   448 QRGARRSHQLPTGVSLPTVMESWMKQPGFPLLTVQRDDAKQIVT--ITQSR--YYQKY-LDNSSN 507
            ....::.||........|::..::   |...|.|...:...|||  :...|  .|:|| |..|: 
 Frog   155 HNILKKYHQFIVECHGNTLLPQFL---GMYRLNVDGVETYMIVTRNVFSHRLSVYRKYDLKGST- 215

  Fly   508 DCWWVPVAYIVRNLTLPQVEWLGCQKNSRDILELSHIANPEDWLLINVDAAVPLRVFYDSYNLQL 572
                  ||                 :.:.|..:...:...:|...|| |..   :::.|..|.:|
 Frog   216 ------VA-----------------REASDKEKAKELPTYKDNDFIN-DGQ---KIYIDENNKKL 253

  Fly   573 ISEALRQDFTQIPELSRIQLVDDAL 597
            ..|.|::|   :..|::::|:|.:|
 Frog   254 FLEKLKKD---VEFLAQLKLMDYSL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6071NP_648488.1 GluZincin 25..477 CDD:301352 32/158 (20%)
ERAP1_C 551..929 CDD:288671 13/47 (28%)
pip4k2aNP_001123723.1 PIPKc_PIP5K2A 26..402 CDD:340446 60/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165173329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.