DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32091 and ABCG2

DIOPT Version :10

Sequence 1:NP_729728.1 Gene:CG32091 / 39307 FlyBaseID:FBgn0052091 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_004818.2 Gene:ABCG2 / 9429 HGNCID:74 Length:655 Species:Homo sapiens


Alignment Length:189 Identity:42/189 - (22%)
Similarity:67/189 - (35%) Gaps:58/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 CTPPMVHRDVKTTNILLNERYGAKLADFGLSRSFPVDGESHVS-TVVAGTPGYLDPEY--YRTNW 761
            |.|..:.::   |.:|::  .|.|.|..|.........:.::. ::.:..||.|...|  :.::.
Human   432 CAPDEICQE---TLLLID--VGQKSAFLGSKGCSSPGAQDNIGVSIFSRLPGMLVASYTKFCSSH 491

  Fly   762 LSEKSDVYSFGVVLLEIVTNQPV--------------------TDKT---RERTH-----INEWV 798
            |...:|..|   |||.|:....|                    ||..   |..||     |....
Human   492 LCNGADSSS---VLLSILPRPDVPPPGDVQCPMCVELFGSCKSTDSVTCPRGATHCYKGDIALQG 553

  Fly   799 GSMLTKGDIKSILDP---KLMGDYDTNGAWKIVELALACVNPSSNRR--------PTMA 846
            |.:.|:..|:..:.|   .|:||..|.|.:...|        |||.|        |::|
Human   554 GGLTTRVSIQGCMAPPIKPLLGDSKTIGIFSAEE--------SSNYRHEDDVTSAPSLA 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32091NP_729728.1 3a01204 30..620 CDD:273361
ABCG2NP_004818.2 3a01204 55..649 CDD:273361 42/189 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.