DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCID2 and THP1

DIOPT Version :9

Sequence 1:NP_648486.1 Gene:PCID2 / 39306 FlyBaseID:FBgn0036184 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_014569.1 Gene:THP1 / 854082 SGDID:S000005433 Length:455 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:72/287 - (25%)
Similarity:115/287 - (40%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GRASEEDT--KRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFK-----------DSFPLP 205
            |.||..:.  |:..::.|||:|..|||||....||        :.|||           :.:.|.
Yeast   161 GNASSTNIPGKQRILLYLVNKLNNIYFRIESPQLC--------SNIFKNFQPKSMLAHFNEYQLD 217

  Fly   206 EQITYKYFVGRRAMFDSNYQAAVQYLSYAFS---NCP---DRFASNKRLILIYLVPVKMLLGYL- 263
            :||.|:|.:||..:.:|....|....:.||.   |.|   .....|...||.|::|..::||.: 
Yeast   218 QQIEYRYLLGRYYLLNSQVHNAFVQFNEAFQSLLNLPLTNQAITRNGTRILNYMIPTGLILGKMV 282

  Fly   264 ---PSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQELVL-IRSGIYLLVEKLKFLVYRNLF 324
               |.:..|.:..:..:..|...::.||:......:|..|..| .|..:.:|:|||..:.||||.
Yeast   283 KWGPLRPFLSQETIDNWSVLYKHVRYGNIQGVSLWLRQNERHLCARQLLIVLLEKLPMVTYRNLI 347

  Fly   325 KKVF---------------VIRKSHQLDMGDFLSALHFVGLTDVSLDETHCIVANLIYDGKIKGY 374
            |.|.               :|.:..||.:|   ......|..:::       :.|.|:..|    
Yeast   348 KTVIKSWTTEWGQNKLPYSLIERVLQLSIG---PTFEDPGAQEIT-------IYNGIHSPK---- 398

  Fly   375 ISHAHNKLV------VSKQNPFPSVSL 395
              :..|.||      :.:.|.||.:.|
Yeast   399 --NVENVLVTLINLGLLRANCFPQLQL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCID2NP_648486.1 PCI <136..391 CDD:295179 69/281 (25%)
THP1NP_014569.1 COG5600 1..438 CDD:227887 72/287 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R253
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.