DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCID2 and C27F2.7

DIOPT Version :9

Sequence 1:NP_648486.1 Gene:PCID2 / 39306 FlyBaseID:FBgn0036184 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_498056.2 Gene:C27F2.7 / 259768 WormBaseID:WBGene00016169 Length:408 Species:Caenorhabditis elegans


Alignment Length:115 Identity:24/115 - (20%)
Similarity:46/115 - (40%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 FPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLILIYLVPVKMLLGYLPSK 266
            :|:...::..:|.....:|.|...::.:  |:.|...||             ..:..::.:|.::
 Worm    96 YPIFGALSPSHFSSPNLLFQSEKNSSRR--SFEFMQLPD-------------TDICQIMSFLDAQ 145

  Fly   267 SLL---QRYDLLLFLDLAMAMKAGNVN--------RFDEIVRDQELVLIR 305
            |||   |....|..|.||....||..:        .|::|.|..|:.|::
 Worm   146 SLLNLSQTCSHLRQLCLAHEDNAGKRDVTSHEITISFNQIHRRTEVRLLK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCID2NP_648486.1 PCI <136..391 CDD:295179 24/115 (21%)
C27F2.7NP_498056.2 F-box 130..>161 CDD:295350 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.