DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AKR1C3

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001240837.1 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens


Alignment Length:314 Identity:130/314 - (41%)
Similarity:201/314 - (64%) Gaps:11/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEV----VTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            |::|..||:||.||: :||||    ..:..|.||:.|:||.|.||:|.||.|||.|:|.|:.:|.
Human    10 LNDGHFMPVLGFGTY-APPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGS 73

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            |.|:::|.|||||:|.|:|:|||||.|.|::...:.|::|||:|.||:.|.| :.|.|| .:..|
Human    74 VKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG-EELSPT-DENGK 136

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKP 196
            ..|:.:|...||.|||...|.||.::|||||||.:|:..:|:.  .|.|||..|:|||||.::..
Human   137 VIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSK 201

  Fly   197 LITLCYDNAIAVTAYSCLGSGHTP-YEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGII 260
            |:..|....|.:.|||.|||.... :..|.:..||:.|.:.|:|:|::||.|.:.||:|.|.|::
Human   202 LLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVV 266

  Fly   261 VIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            |:.:|.::|.:..|. ::::|:|..:|::||:.||.|..:....:...||::|:
Human   267 VLAKSYNEQRIRQNV-QVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 127/298 (43%)
Tas 17..293 CDD:223739 120/282 (43%)
AKR1C3NP_001240837.1 ARA1 9..305 CDD:223729 127/298 (43%)
Tas 17..297 CDD:223739 120/283 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.