DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and YJR096W

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W / 853559 SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:91/298 - (30%)
Similarity:161/298 - (54%) Gaps:37/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PNFL-LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDE- 66
            |.|. ||||..:|.:.|||:..|.....:.|.:.:..||||||.|.:||||.:||..:.:.::| 
Yeast     3 PKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNED 67

  Fly    67 -GVVTRDELFITSKLWNTHHKPDLVRPACETSIRNL-GVKYLNLYLMHWPMAYKSGSDNLYPTCP 129
             |...|:|:|.|:||||:.:.....:.|....:..: |::|::|.|:|.|:              
Yeast    68 PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------------- 118

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKL--KPVVLQIECHPYL 192
            :.:|...|      |||||:..|||||.::|||||:.::.::.||:..:|  ||||.|||..|::
Yeast   119 EGSKLRLE------TWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWI 177

  Fly   193 SQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQS 257
            .::.|...|....:.|.|::.|..|:.          :.:|.:|.:.::.:|...|||:|:..|.
Yeast   178 MRQELADYCKSKGLVVEAFAPLCHGYK----------MTNPDLLKVCKEVDRNPGQVLIRWSLQH 232

  Fly   258 GIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELD 295
            |.:.:|::.:.:.:..|. ..::|||:.:.::.::..|
Yeast   233 GYLPLPKTKTVKRLEGNL-AAYNFELSDEQMKFLDHPD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 91/298 (31%)
Tas 17..293 CDD:223739 83/280 (30%)
YJR096WNP_012630.1 AKR_AKR1-5-like 14..266 CDD:381297 84/282 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.670

Return to query results.
Submit another query.