DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and ARA1

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:112/305 - (36%)
Similarity:174/305 - (57%) Gaps:35/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLSNGKNMPMLGLGTWRSPPEVVT---QAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEG 67
            |.|:||..:|.||||| .:|.|.:.   ||||.||..||||.|.|..|..|..||.|::|.:::|
Yeast    25 FSLNNGVRIPALGLGT-ANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDG 88

  Fly    68 VVTRDELFITSKLWNTHHKP---DLVRPACETSIRNLGVKYLNLYLMHWPMAYK-----SGSDNL 124
            .:.|::||||:|:|     |   |.|..:...|::.||::|::|.|.|||:.::     .|...|
Yeast    89 SIKREDLFITTKVW-----PVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGISGL 148

  Fly   125 YPT-CPDTNKAAF-EDIDYVDTWRAMENLV---DEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVL 184
            ..| ..|:.|..: .|.||::|::.:|.:.   ::...:|||||||:.:.:.||:...::||.|.
Yeast   149 VKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVN 213

  Fly   185 QIECHPYLSQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQV 249
            |:|.||:|.|..|...|:.:.|.:||||.||| |      || |.|:.|.:..:||||..|...:
Yeast   214 QVETHPHLPQMELRKFCFMHDILLTAYSPLGS-H------GA-PNLKIPLVKKLAEKYNVTGNDL 270

  Fly   250 LLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDF-ELAVDDIQAINE 293
            |:.:..:.|.||||||::...:..:.    :| .|..|::|.:|:
Yeast   271 LISYHIRQGTIVIPRSLNPVRISSSI----EFASLTKDELQELND 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 112/305 (37%)
Tas 17..293 CDD:223739 106/292 (36%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 112/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.