DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and YDL124W

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_010159.1 Gene:YDL124W / 851433 SGDID:S000002282 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:95/328 - (28%)
Similarity:155/328 - (47%) Gaps:62/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLSNGKNMP---MLGLGT-WRSPPEV-------VTQAVKDAIDI-GYRHFDCAHIYGNEAQVGA 58
            |.|:||..:|   ::|.|| |....|.       :.:.:..|:.: |..|.|.|.||....:||.
Yeast     8 FTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPEVGK 72

  Fly    59 A--LREKMDEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGS 121
            |  |.||      .|:.:|:|.|........|......:.:::.:|..|::|||:|.|...|   
Yeast    73 ALSLTEK------PRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPFVSK--- 128

  Fly   122 DNLYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQI 186
                    :.|..:.|     :.|:.||.|...|..:.||||||..:.:.|:|.||::||.|.||
Yeast   129 --------EVNGLSLE-----EAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVKPQVNQI 180

  Fly   187 ECHPYL-SQKP-LITLCYDNAIAVTAYSCLGSGHTPYEKPGA----YPLLQHPTILAIAEKYERT 245
            |..|:| :|.| :...|.::.|.|.|||.||    |.:|..|    .|..::  :..::|||.::
Yeast   181 EFSPFLQNQTPGIYKFCQEHDILVEAYSPLG----PLQKKTAQDDSQPFFEY--VKELSEKYIKS 239

  Fly   246 AAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHP 310
            .||::||:.|:.|::.:..| ||...:.:.:.::.|:|..:::..|.||             |..
Yeast   240 EAQIILRWVTKRGVLPVTTS-SKPQRISDAQNLFSFDLTAEEVDKITEL-------------GLE 290

  Fly   311 HHP 313
            |.|
Yeast   291 HEP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 92/313 (29%)
Tas 17..293 CDD:223739 85/292 (29%)
YDL124WNP_010159.1 AKR_AKR3C2-3 13..291 CDD:381346 90/319 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.