DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AT5G62420

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_201048.1 Gene:AT5G62420 / 836363 AraportID:AT5G62420 Length:316 Species:Arabidopsis thaliana


Alignment Length:288 Identity:112/288 - (38%)
Similarity:169/288 - (58%) Gaps:14/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GKNMPMLGLGTW--RSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDE 73
            |:.:|:||:||:  :...|....||..||.|||||||.|.|||:|..:|.||.:.:..|.|.||:
plant    11 GETIPLLGMGTYCPQKDRESTISAVHQAIKIGYRHFDTAKIYGSEEALGTALGQAISYGTVQRDD 75

  Fly    74 LFITSKLWNT-HHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFE 137
            ||:|||||:: ||.|  :....:| ::.:|:.||:.||:|||:..|.|.....|...:..|    
plant    76 LFVTSKLWSSDHHDP--ISALIQT-LKTMGLDYLDNYLVHWPIKLKPGVSEPIPKEDEFEK---- 133

  Fly   138 DIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLITLCY 202
            |:...:||:.||..::.|||::||||||:.:::..||..|.:.|.|.|:|.||...|:.|..:|.
plant   134 DLGIEETWQGMERCLEMGLCRSIGVSNFSSKKIFDLLDFASVSPSVNQVEMHPLWRQRKLRKVCE 198

  Fly   203 DNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVS 267
            :|.|.|:.||.||.   |....|:..:::||.|.:||.|:..|.|||.||:....|..||.:|.:
plant   199 ENNIHVSGYSPLGG---PGNCWGSTAVIEHPIIKSIALKHNATPAQVALRWGMSKGASVIVKSFN 260

  Fly   268 KQHMLDNFKRIWDFELAVDDIQAINELD 295
            ...|::| ||..:.:|...|:..|:.|:
plant   261 GARMIEN-KRALEIKLDDQDLSLIDHLE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 112/288 (39%)
Tas 17..293 CDD:223739 109/278 (39%)
AT5G62420NP_201048.1 AKR_AKR4A_4B 10..288 CDD:381350 112/288 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.