DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AT5G01670

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_850750.1 Gene:AT5G01670 / 831701 AraportID:AT5G01670 Length:349 Species:Arabidopsis thaliana


Alignment Length:317 Identity:109/317 - (34%)
Similarity:165/317 - (52%) Gaps:41/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVV 69
            :|.|.:|..:|.:|||||||..:.....|...::.||||.|.|..||::.:||..::..|..|:.
plant    15 SFRLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLE 79

  Fly    70 TRDELFITSKLWN---------------------------THHKPDLVRPACETSIRNLGVKYLN 107
            .|| ||:|||||.                           |...|:.||||.:.:::.|.::||:
plant    80 RRD-LFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLD 143

  Fly   108 LYLMHWPMAYKSGSDNLYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNR 172
            |||:|||:..:.|:.. .|...|.     .|.|....||.||||..:.|.:.|||.||...::|:
plant   144 LYLIHWPIRLREGASK-PPKAGDV-----LDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNK 202

  Fly   173 LLSVAKLKPVVLQIECHPYLSQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILA 237
            ||..|:|.|.|.|:|.||......::..|..|.|.|||||.|||      :.|...|:...|:..
plant   203 LLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGS------QEGGRDLIHDQTVDR 261

  Fly   238 IAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINEL 294
            ||:|..:|..|:|:::..|.|..|||:|::.:.:.:|.| ::|:.:...|.||:|.:
plant   262 IAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIK-VFDWVIPEQDFQALNSI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 109/317 (34%)
Tas 17..293 CDD:223739 104/302 (34%)
AT5G01670NP_850750.1 ARA1 11..317 CDD:223729 109/315 (35%)
Tas 13..317 CDD:223739 109/315 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.