DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AKR4C11

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_190956.1 Gene:AKR4C11 / 824555 AraportID:AT3G53880 Length:315 Species:Arabidopsis thaliana


Alignment Length:275 Identity:110/275 - (40%)
Similarity:165/275 - (60%) Gaps:20/275 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVT 70
            |.|:.|..:|.:|||||::.|.||..||..|:.|||:|.|||..||||.::|..|::..|:|||.
plant     8 FQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGKVLKKLFDDGVVK 72

  Fly    71 RDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGS-----DNLYPTCPD 130
            |::||||||:|.|...|..|:.|...::::|.:.|::|||||||:..|.|:     :|:.|    
plant    73 REKLFITSKIWLTDLDPPDVQDALNRTLQDLQLDYVDLYLMHWPVRLKKGTVDFKPENIMP---- 133

  Fly   131 TNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQK 195
                    ||...||:|||.|||.|..:|||||||:.::::.|:..|::.|.|.|:||||...|.
plant   134 --------IDIPSTWKAMEALVDSGKARAIGVSNFSTKKLSDLVEAARVPPAVNQVECHPSWQQH 190

  Fly   196 PLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGII 260
            .|...|....|.::.||.|||..|.:.|.   .:|:.|.|..||::..::.||..||:..|.|..
plant   191 KLHEFCKSKGIHLSGYSPLGSPGTTWVKA---DVLKSPVIEMIAKEIGKSPAQTALRWGLQMGHS 252

  Fly   261 VIPRSVSKQHMLDNF 275
            ::|:|.::..:.:||
plant   253 ILPKSTNEGRIRENF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 110/275 (40%)
Tas 17..293 CDD:223739 106/264 (40%)
AKR4C11NP_190956.1 AKR_AKR4C1-15 6..292 CDD:381351 110/275 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.