DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AT2G21260

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_179722.1 Gene:AT2G21260 / 816665 AraportID:AT2G21260 Length:309 Species:Arabidopsis thaliana


Alignment Length:301 Identity:116/301 - (38%)
Similarity:175/301 - (58%) Gaps:19/301 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |::|..||::|||.||...|.:...:.|||.|||||.|||..|.|||:||.||.|....|:|.|:
plant     5 LNSGFKMPIIGLGVWRMEKEELRDLIIDAIKIGYRHLDCAANYKNEAEVGEALTEAFTTGLVKRE 69

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFE 137
            :||||:|||::.|  ..|..||:.|::.|.:.||:|:|:|.|:|.|.       |...|..:|..
plant    70 DLFITTKLWSSDH--GHVIEACKDSLKKLQLDYLDLFLVHIPIATKH-------TGIGTTDSALG 125

  Fly   138 DIDYVD---------TWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLS 193
            |...:|         ||..||.||..||.::||:||::.......|:.:|:||.|.|||.|||..
plant   126 DDGVLDIDTTISLETTWHDMEKLVSMGLVRSIGISNYDVFLTRDCLAYSKIKPAVNQIETHPYFQ 190

  Fly   194 QKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSG 258
            :..|:..|..:.|.|||::.||......|..|....|..|.:..:||||::|.||::||:..|..
plant   191 RDSLVKFCQKHGICVTAHTPLGGATANAEWFGTVSCLDDPVLKDVAEKYKQTVAQIVLRWGIQRN 255

  Fly   259 IIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGR 299
            .:|||::...:.:.:|| :::||:|:.:|::.|..::.|.|
plant   256 TVVIPKTSKPERLEENF-QVFDFQLSKEDMEVIKSMERNYR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 116/301 (39%)
Tas 17..293 CDD:223739 110/284 (39%)
AT2G21260NP_179722.1 AKR_AKR2A1-2 1..308 CDD:381338 116/301 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.