DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1a1

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_112262.1 Gene:Akr1a1 / 78959 RGDID:68346 Length:325 Species:Rattus norvegicus


Alignment Length:324 Identity:140/324 - (43%)
Similarity:213/324 - (65%) Gaps:13/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMD 65
            |:..:.||..|:.||::|||||:|.|..|..|:|.|:.:||||.|||.:||||.::|.||:|.:.
  Rat     1 MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVG 65

  Fly    66 EG-VVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCP 129
            .| .|.|:|||:|||||||.|.|:.|.||...::.:|.::||:|||||||.|::.| ||.:|...
  Rat    66 AGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERG-DNPFPKNA 129

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQ 194
            | ....::...|.:||:|:|.||.:||.:|:|:|||:.:|::.:||||.::|.|||:||||||:|
  Rat   130 D-GTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQ 193

  Fly   195 KPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGI 259
            ..||..|....:.|||||.|||....:..|....||:.|.:||:|||:.|:.||:|||:|.|..:
  Rat   194 NELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKV 258

  Fly   260 IVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMT---------MKAAYGHPHHPF 314
            |.||:|::...:|.|. :::||..:.::::.::.|:.|.|::.         :....|||.:||
  Rat   259 ICIPKSITPSRILQNI-QVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 134/299 (45%)
Tas 17..293 CDD:223739 126/276 (46%)
Akr1a1NP_112262.1 AKR_AKR1A1-4 8..312 CDD:381332 133/306 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - oto95680
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.