DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c21

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_084177.2 Gene:Akr1c21 / 77337 MGIID:1924587 Length:323 Species:Mus musculus


Alignment Length:317 Identity:122/317 - (38%)
Similarity:189/317 - (59%) Gaps:15/317 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSNGKNMPMLGLGT---WRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            :|::|..:|:||.||   ...|.....:..|.|||.|:.|||.|.:|..|..||.|:|.|:.:|.
Mouse     9 ILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGT 73

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            |.|:::|.|||:|.|...|:|||.:.|.|::.|...|::|||:|:|||.|.|.:| :|. .:..|
Mouse    74 VRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEEN-FPV-DEHGK 136

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKP 196
            ..|:.:|...||.|||...|.||.::|||||||.:|:..:|:.  .|.|||..|:||||||:|..
Mouse   137 LIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMK 201

  Fly   197 LITLCYDNAIAVTAYSCLGS----GHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQS 257
            |:..|....|.:.||..||:    |......|   .||..|.:.::|:||.||.|.:.||:|.|.
Mouse   202 LLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSP---VLLDEPVLGSMAKKYNRTPALIALRYQLQR 263

  Fly   258 GIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            ||:|:..|:.::.:.:|. ::::|:|:.:|::.::.|:.|.|::......|||:.||
Mouse   264 GIVVLNTSLKEERIKENM-QVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 116/301 (39%)
Tas 17..293 CDD:223739 111/284 (39%)
Akr1c21NP_084177.2 AKR_AKR1C1-35 6..308 CDD:381334 117/304 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.