DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and LOC734139

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001039264.1 Gene:LOC734139 / 734139 -ID:- Length:324 Species:Xenopus tropicalis


Alignment Length:320 Identity:122/320 - (38%)
Similarity:193/320 - (60%) Gaps:23/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTW---RSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVV 69
            ||:|..||:||.||:   :||..:..:..|.|||:||||.|||.|||||.:||.|:..|:.:|.|
 Frog    11 LSDGHKMPVLGFGTYAPQKSPKHLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIGAKIADGTV 75

  Fly    70 TRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKA 134
            .|:::|.|.|||::.|.|:.||...|.|:::|.:.|::|:::|.||.:|.|.|.|  ...:..|.
 Frog    76 KREDVFYTGKLWSSFHTPERVRVCLEKSLKDLQLDYMDLFIIHNPMEFKPGDDPL--PLDENGKL 138

  Fly   135 AFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPL 197
            .:.:.|..|||:|:|...|.||.::|||||||.:|:..:|::  .|.|||..|:|||.||:|..|
 Frog   139 IYHNTDIRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLNQSKL 203

  Fly   198 ITLCYDNAIAVTAYSCLGSG--------HTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQ 254
            :..|....|.:..||.|||.        ::|.       ||:.|.:..||:|..||.|||.:|:.
 Frog   204 LEFCKSKDIVLVGYSVLGSSRDERWIDQNSPV-------LLEDPVLNVIAKKLNRTPAQVAMRYL 261

  Fly   255 TQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .|.|::|:.:|.:...:..|| :::||:|..:|:::::.|:.:.|::.......||.:||
 Frog   262 LQRGVVVLAKSFTPARIQQNF-QVFDFQLDAEDMKSLDGLNRHLRYVDTTTWSDHPKYPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 117/304 (38%)
Tas 17..293 CDD:223739 111/288 (39%)
LOC734139NP_001039264.1 ARA1 9..307 CDD:223729 118/305 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.