DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1b10

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_765986.3 Gene:Akr1b10 / 67861 MGIID:1915111 Length:316 Species:Mus musculus


Alignment Length:309 Identity:142/309 - (45%)
Similarity:202/309 - (65%) Gaps:5/309 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |..|..||::|||||:|||..|.:|||.|||.||||.|||::|.||::||.|::||:.|..|.|:
Mouse     7 LLTGAKMPIVGLGTWKSPPAKVREAVKVAIDAGYRHIDCAYVYQNESEVGEAIQEKIQEKAVKRE 71

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFE 137
            :|||.||||:|..:..||:.|.:.::.:|.:.||:|||:|||..::||  |::....|.......
Mouse    72 DLFIVSKLWSTFFEKSLVKKAFQNTLSDLKLDYLDLYLIHWPQGFQSG--NVFLPTDDKGSILSS 134

  Fly   138 DIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPLITL 200
            ...::|.|.|||.|||:||.:|:||||||..|:.|||:.  .|.|||..|:||||||:|:.||..
Mouse   135 KYTFLDAWEAMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQY 199

  Fly   201 CYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRS 265
            |:...|.:||||.|||...|..||....||:.|.|..||.|::|||||||:||..:..::|||:|
Mouse   200 CHSKGITITAYSPLGSPDRPSAKPEDPLLLEIPKIKEIAAKHKRTAAQVLIRFHIERNVVVIPKS 264

  Fly   266 VSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            |:...:.:|. :::||:|:.:|:.||...:.|.|...:.||..:...||
Mouse   265 VTPSRIQENI-QVFDFQLSEEDMAAILSFNRNWRACGLFAASHNEDFPF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 137/293 (47%)
Tas 17..293 CDD:223739 132/277 (48%)
Akr1b10NP_765986.3 ARA1 1..297 CDD:223729 137/292 (47%)
Tas 9..289 CDD:223739 133/282 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.