DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AKR1B10

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_064695.3 Gene:AKR1B10 / 57016 HGNCID:382 Length:316 Species:Homo sapiens


Alignment Length:309 Identity:143/309 - (46%)
Similarity:203/309 - (65%) Gaps:5/309 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            ||....||::|||||:||...|.:|||.|||.||||.|||::|.||.:||.|::||:.|..|.|:
Human     7 LSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKRE 71

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFE 137
            :|||.||||.|..:..|||.|.|.::::|.:.||::||:|||..:||| |:|:|. .|...|...
Human    72 DLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSG-DDLFPK-DDKGNAIGG 134

  Fly   138 DIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPLITL 200
            ...::|.|.|||.||||||.:|:|||||:..|:.:||:.  .|.|||..|:||||||:|:.||..
Human   135 KATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQY 199

  Fly   201 CYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRS 265
            |:...|.|||||.|||...|:.||....||:.|.|..||.|:::||||||:||..|..:||||:|
Human   200 CHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKS 264

  Fly   266 VSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            |:...:::|. :::||:|:.:::..|...:.|.|...:..:.....:||
Human   265 VTPARIVENI-QVFDFKLSDEEMATILSFNRNWRACNVLQSSHLEDYPF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 140/293 (48%)
Tas 17..293 CDD:223739 135/277 (49%)
AKR1B10NP_064695.3 AKR_AKR1B1-19 10..316 CDD:381333 141/306 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.