DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and zgc:110782

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001013503.1 Gene:zgc:110782 / 541358 ZFINID:ZDB-GENE-050320-51 Length:287 Species:Danio rerio


Alignment Length:301 Identity:110/301 - (36%)
Similarity:166/301 - (55%) Gaps:24/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPNFLLSNGKNMPMLGLGTWR-SPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKM 64
            |..|:..|.:|..||:|||||:: ...|.:.|:|..|:..|||.||.|.:|||||.:|..|:|.:
Zfish     1 MIVPSVRLMSGTQMPLLGLGTYKLQDHEQLKQSVSCALQAGYRAFDTAAVYGNEAHLGQVLKELL 65

  Fly    65 DEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCP 129
            .:..:.|:::||.|||..:.|.. ..:..|..|:..|..:|::|||:|||     |.:.|.|  .
Zfish    66 PKYGLIREDVFIISKLAPSDHGL-RAKEGCLRSLEQLDCEYIDLYLIHWP-----GMEGLDP--E 122

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQ 194
            |:..:.:.    ..:|..:|.....|..:||||||:..:.:..||:..::.|.||||||.|.|.|
Zfish   123 DSRHSEYR----AQSWATLEEFHASGQFKAIGVSNYTAKHIRELLASCRVPPAVLQIECQPKLIQ 183

  Fly   195 KPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGI 259
            :.|..||.:..|...|||.||.|          .||:.|.::.|.....||.||||||:..|.||
Zfish   184 RELRDLCMETGIHFQAYSSLGKG----------ALLREPEVMDIVRHCGRTPAQVLLRWALQQGI 238

  Fly   260 IVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRF 300
            .|:|||.....:|:| .:::||:|...|::.:::|:|..||
Zfish   239 SVLPRSSQPSRVLEN-AQVFDFKLNETDMKRLDDLNCGTRF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 108/299 (36%)
Tas 17..293 CDD:223739 100/276 (36%)
zgc:110782NP_001013503.1 ARA1 1..280 CDD:223729 110/301 (37%)
Tas 17..271 CDD:223739 100/276 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.