DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c12l1

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001129216.1 Gene:Akr1c12l1 / 498790 RGDID:1559604 Length:323 Species:Rattus norvegicus


Alignment Length:314 Identity:118/314 - (37%)
Similarity:189/314 - (60%) Gaps:11/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEV----VTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            |::|..:|.||.|| ..|.||    ..:||..|||.||.|.|.|..|..|.::|.|::.|:..||
  Rat    10 LNDGHFIPALGFGT-SIPNEVPKSKSLEAVHLAIDAGYHHIDTASAYQIEEEIGQAIQSKIKAGV 73

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            |.|:::|||:|||.|..:|:||:||.|.|::||.:.|.:||:||:|:..||| |...|. .|..|
  Rat    74 VKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMKSG-DKYLPV-DDKGK 136

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKP 196
            ...:.:|:.|||..:|...|.||.::|||||||.:|:.|||:.  .|.|||..|:|||.|::|..
  Rat   137 WLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYMNQSK 201

  Fly   197 LITLCYDNAIAVTAYSCLGS-GHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGII 260
            |:..|....|.:.||..||: .:..:....:..||..|.:..:|:|.:|:.|.:.||:..|..::
  Rat   202 LLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPVLCDVAKKNKRSPALIALRYLVQREVV 266

  Fly   261 VIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .:.:|..:..|.:|. ::::|:|:.:|::.::.|:.|.|:::.:...|||.:||
  Rat   267 PLAQSFKENEMRENL-QVFEFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 112/298 (38%)
Tas 17..293 CDD:223739 107/282 (38%)
Akr1c12l1NP_001129216.1 ARA1 8..305 CDD:223729 112/298 (38%)
Tas 16..297 CDD:223739 108/284 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.