DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and akr1b1

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001011130.1 Gene:akr1b1 / 496546 XenbaseID:XB-GENE-5821742 Length:318 Species:Xenopus tropicalis


Alignment Length:309 Identity:142/309 - (45%)
Similarity:205/309 - (66%) Gaps:5/309 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |..|..||::|||||:|.|..||.||..||::||||.|||::|.||.:||..:::|:.||:|.|:
 Frog     9 LYTGAQMPIVGLGTWKSEPGKVTAAVAKAIEVGYRHLDCAYVYQNENEVGEGIQQKIKEGLVKRE 73

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFE 137
            :||:.||||:|.|...:|:.||:.::.:|.:.||:|||:|||..:::| |.|:| ..:.......
 Frog    74 DLFVVSKLWSTFHDKSMVKGACQKTLSDLKLDYLDLYLVHWPTGFQAG-DALFP-LDNEGCVIHS 136

  Fly   138 DIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPLITL 200
            :..::|||..||.|||.||.:|||:||||.:|:.:||:.  .|.||.|.|.||||||:||.||.|
 Frog   137 NTHFLDTWEGMEELVDAGLVKAIGISNFNREQIEQLLNKPGLKHKPAVHQFECHPYLTQKKLIDL 201

  Fly   201 CYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRS 265
            |....|.|||||.|||...|:.||....||:.|.|..||:||.:|:||||:||..|..::|||:|
 Frog   202 CQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEEPKIKEIAKKYNKTSAQVLIRFHIQRNVVVIPKS 266

  Fly   266 VSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            |:...:.:|| :::||||:.:|.:||...:...|...:.:|..|..:||
 Frog   267 VTPARIEENF-QVFDFELSPEDTEAIFSFERGWRVCALSSAKKHKDYPF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 137/293 (47%)
Tas 17..293 CDD:223739 133/277 (48%)
akr1b1NP_001011130.1 AKR_AKR1B1-19 12..318 CDD:381333 141/306 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.