DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and zgc:101765

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 / 450036 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio


Alignment Length:298 Identity:116/298 - (38%)
Similarity:169/298 - (56%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PNFLLSNGKNMPMLGLGTWR-SPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEG 67
            |:.||:|...||:|||||:| ...|....||..|:..|||.||.|.:|.|||.:|.|||..:.:.
Zfish     6 PSVLLNNDIQMPLLGLGTFRLQGQEDTYSAVDAALKAGYRAFDTAAVYRNEAHLGHALRCLLPKH 70

  Fly    68 VVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTN 132
            .::|:::|||||| ....:....|..|:.|:..||:.|::|||:|||     |:..|    |..:
Zfish    71 GLSREDVFITSKL-GPKDQGSKARNGCQKSLEQLGLGYIDLYLIHWP-----GTQGL----PVGD 125

  Fly   133 KAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPL 197
            |...|  :...:||.:|....||..:||||||:..:.|..||...|:.|.|||:|.||.|.|..|
Zfish   126 KRNPE--NRAQSWRVLEEFYSEGKFRAIGVSNYTVEHMQELLKSCKVPPAVLQVEFHPKLLQNDL 188

  Fly   198 ITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVI 262
            ..||....:...|||.||:|          .||.:|.:|.||::..||.||||||:..|..|.|:
Zfish   189 RGLCKIRGVCFQAYSSLGTG----------LLLSNPVVLEIAKECGRTPAQVLLRWAVQQSIAVL 243

  Fly   263 PRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRF 300
            |:|...:.:.:| .|::|||::.:|::.::.|||..:|
Zfish   244 PKSSQPERVKEN-GRLFDFEISEEDMERLSALDCGEKF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 115/296 (39%)
Tas 17..293 CDD:223739 106/276 (38%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 116/298 (39%)
Tas 11..271 CDD:223739 109/282 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.