DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AKR1B15

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:289 Identity:127/289 - (43%)
Similarity:185/289 - (64%) Gaps:5/289 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDELFITSKLWNTHHKPDLVRPA 93
            |.:|||.|||..|||.|||:.|.|:.:||.|::||:.|..|.|::|||.||:|.|..:..|||.|
Human    56 VKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWPTFFERPLVRKA 120

  Fly    94 CETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQ 158
            .|.::::|.:.||::||:|||..:|:| |:.:|.....|..:.:. .::|.|.|||.||||||.:
Human   121 FEKTLKDLKLSYLDVYLIHWPQGFKTG-DDFFPKDDKGNMISGKG-TFLDAWEAMEELVDEGLVK 183

  Fly   159 AIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPLITLCYDNAIAVTAYSCLGSGHTPY 221
            |:||||||..|:.|||:.  .|.|||..|:||||||:|:.||..|:...|.|||||.|||...|:
Human   184 ALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPW 248

  Fly   222 EKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVD 286
            .||....||:.|.|..||.|:::|.||||:||..|..:.|||:|::..|:::|. :::||:|:.:
Human   249 AKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENI-QVFDFKLSDE 312

  Fly   287 DIQAINELDCNGRFMTMKAAYGHPHHPFE 315
            ::..|...:.|.|....|........||:
Human   313 EMATILSFNRNWRAFDFKEFSHLEDFPFD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 123/272 (45%)
Tas 17..293 CDD:223739 122/265 (46%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 123/271 (45%)
Tas 57..317 CDD:223739 120/262 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.