DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and akr1b1.1

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001002048.1 Gene:akr1b1.1 / 415138 ZFINID:ZDB-GENE-040625-7 Length:315 Species:Danio rerio


Alignment Length:314 Identity:144/314 - (45%)
Similarity:201/314 - (64%) Gaps:17/314 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |:||..||::|||||||||..||:|||.||..||||.|.||:|.||.:||..:...:::|||.|:
Zfish     6 LNNGAKMPIVGLGTWRSPPGEVTEAVKSAILSGYRHIDGAHVYENENEVGDGICAMINQGVVKRE 70

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYP------TCPDT 131
            :|||.||||.|.|:..|||.|||.::.:|.:.|::|||||:||..|.|.| |:|      ..||.
Zfish    71 DLFIVSKLWCTFHEKHLVRGACEKTLSDLKLDYVDLYLMHFPMGTKPGKD-LFPLDKDGHVIPDN 134

  Fly   132 NKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQ 194
            :       ::::||.|||.|||.||.:|||:||||..|:..:|:.  .|.||...||||||||:|
Zfish   135 S-------NFLETWEAMEELVDAGLVKAIGISNFNRDQIEAILNKPGLKYKPANNQIECHPYLTQ 192

  Fly   195 KPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGI 259
            :.||..|....|.|||||.|||.:.|:.:.....||:.|.|.|||:|:.:|.||||:.|..|..:
Zfish   193 EKLINYCQSKGITVTAYSPLGSPNRPWAQADEPSLLEDPKIKAIADKHGKTTAQVLIHFHIQRNV 257

  Fly   260 IVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHP 313
            :|||:||:...:.:||: ::||||:.:::..|...:.|.|...::.|..|...|
Zfish   258 VVIPKSVTPSRIKENFE-VFDFELSKEEMNTILSFNRNFRAFGLEWASKHKDFP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 140/299 (47%)
Tas 17..293 CDD:223739 134/283 (47%)
akr1b1.1NP_001002048.1 ARA1 1..296 CDD:223729 140/298 (47%)
Tas 1..288 CDD:223739 138/290 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm25278
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.