DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and CG2767

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:327 Identity:118/327 - (36%)
Similarity:179/327 - (54%) Gaps:23/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMD 65
            ::|.....:||:.||::|:|||::..|.:..|:..|::.||||.|.|.:||||..:|..|:..:|
  Fly     2 VNTKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLD 66

  Fly    66 EGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPM--------AYKSGSD 122
            .|.|.|:||||.:|:....::|..|.|..:.|:.:|.:.|::|||:|.|.        ::|...:
  Fly    67 AGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKE 131

  Fly   123 NLYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIE 187
            .|......||.||.        |.|||.||::||.::||||||::.|:.|||...|::|...|||
  Fly   132 GLMEVDVTTNHAAI--------WVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIE 188

  Fly   188 CHPYLSQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGA-----YP-LLQHPTILAIAEKYERTA 246
            .|.||.|:.|:..|....|.|||||.|||........||     .| |:..|.:..||..:.:|.
  Fly   189 HHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTP 253

  Fly   247 AQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPH 311
            ||||||:...:|:..||:|.:...:..|.. ::||||..:::..::.||.|.|.......:|...
  Fly   254 AQVLLRWIIDTGVSAIPKSTNPARLKQNLD-VFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER 317

  Fly   312 HP 313
            ||
  Fly   318 HP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 114/312 (37%)
Tas 17..293 CDD:223739 106/289 (37%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 111/305 (36%)
Tas 10..297 CDD:223739 110/295 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I232
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
87.920

Return to query results.
Submit another query.