DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1B

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster


Alignment Length:312 Identity:163/312 - (52%)
Similarity:219/312 - (70%) Gaps:3/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            |..:..:|..:|::||||:.||...||:|||.|||.||||.|||::|.||.:||..:..|:.|||
  Fly    38 PKVVCLDGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGV 102

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            |.|::||||||||||.|:||||:.|.|.::.:|.:|||:|||:||||.||.|.| |:||..| .|
  Fly   103 VKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCD-LFPTDKD-GK 165

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLI 198
            ..:..:||||||:|||.||:|||.::|||||||.:|:.|:|.||.:.||..||||||||:||.||
  Fly   166 TLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLI 230

  Fly   199 TLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIP 263
            ..|....|.:||||.|||.:.|:.|.|...:|:...|..||.|.::|..|:|:|:|.|...||||
  Fly   231 DFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIP 295

  Fly   264 RSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPFE 315
            :||:|..:..|| :::||||..::|:.|...:||||.:.:...|||||||||
  Fly   296 KSVTKDRIESNF-QVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 153/295 (52%)
Tas 17..293 CDD:223739 147/275 (53%)
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 148/280 (53%)
Tas 45..>248 CDD:223739 118/204 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468204
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1110.800

Return to query results.
Submit another query.