DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and CG10863

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster


Alignment Length:307 Identity:132/307 - (42%)
Similarity:195/307 - (63%) Gaps:6/307 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDE 73
            :||..:..:||||:.|......:|...|||:||||.|.|:.|.||.:||||::.|:.|||:.|::
  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKRED 75

  Fly    74 LFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDN-LYPTCPDTNKAAFE 137
            :.||:|||...|:|..|..||..:::|.|::|::|||||||.:|....|| :.|| ....:....
  Fly    76 IHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPT-DAKGEVELN 139

  Fly   138 DIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLITLCY 202
            ||||:||||.||.||:.||.::|||||||.:|:.|||:..|:||:..||||||.|:||.||.||.
  Fly   140 DIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCK 204

  Fly   203 DNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVS 267
            .|.|.||||..||..: |.||...|  :....:.||.:||:::.|||:||:..:.|.|.:|:|.:
  Fly   205 KNDIVVTAYCPLGRPN-PAEKTPNY--IYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSN 266

  Fly   268 KQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .:.:.:|| :|:||:|..:|...::..:...|.:.|..|....::||
  Fly   267 PKRIEENF-QIFDFQLDAEDHAILDSYNTGERLIPMTHAIKSKNYPF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 127/291 (44%)
Tas 17..293 CDD:223739 125/276 (45%)
CG10863NP_647840.1 ARA1 6..304 CDD:223729 129/297 (43%)
Tas 11..290 CDD:223739 127/283 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468209
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1110.800

Return to query results.
Submit another query.