DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c12

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:316 Identity:115/316 - (36%)
Similarity:190/316 - (60%) Gaps:15/316 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEV----VTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            |::|..:|.||.||:: |.||    ..:|...|||:||||.|.|..|..|.::|.|::.|:..||
  Rat    10 LNDGHFIPALGFGTYK-PKEVPKSKSLEAAHLAIDVGYRHIDTASAYQVEEEIGQAIQSKIKAGV 73

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            |.|.::|||:|||.:..:.::||||.|.|::||.:.|::|:|:|:|:..||..|.    .|...|
  Rat    74 VKRKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDE----SPLDEK 134

  Fly   134 AAF--EDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQ 194
            ..|  :.:|:.|||..:|...|.||.::|||||||.:|:.|||:.  .|.|||..|:|||.||:|
  Rat   135 GKFLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQ 199

  Fly   195 KPLITLCYDNAIAVTAYSCLGS-GHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSG 258
            ..|:..|....|.:.||..||: .:..:....:..||..|.:..:|:|.:|:.|.:.||:..|.|
  Rat   200 SKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPILCDVAKKNKRSPALIALRYLFQRG 264

  Fly   259 IIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            ::.:.:|..:..|.:|. ::::|:|:.:|::.::.|:.|.|:::.:....||.:||
  Rat   265 VVPLAQSFKENEMRENL-QVFEFQLSPEDMKTLDGLNKNFRYLSAEFLADHPEYPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 110/300 (37%)
Tas 17..293 CDD:223739 105/284 (37%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 110/300 (37%)
Tas 16..297 CDD:223739 106/286 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.