DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and CG9436

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster


Alignment Length:318 Identity:134/318 - (42%)
Similarity:194/318 - (61%) Gaps:23/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            |...|:||:.||.||||||:|.......:.:.|:|:||||.|.|.:|.|||:||.|:.||:.|||
  Fly     6 PTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGV 70

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSD-NLYPTCPDTN 132
            |||:|:|:|:||...||.|.||..||..|:.|||::|::|||||.|:..|..:| |::.|...| 
  Fly    71 VTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLELT- 134

  Fly   133 KAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPL 197
                 |:||:||||.||.|||.||.::||:||||..|..|:|:..:::|||.|:||||...|:.|
  Fly   135 -----DVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQL 194

  Fly   198 ITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTIL------AIAEKYERTAAQVLLRFQTQ 256
            ......:.:.:.|| |      |..:|  .|..|.|..|      .:|:||.||.||:.||:..|
  Fly   195 REHAKRHGLVICAY-C------PLARP--QPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQ 250

  Fly   257 SGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .|::.:|:|.:|..:.:|| |::||||:.||:..:.:.....|.:......||.::||
  Fly   251 LGVVPLPKSSNKARIEENF-RVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 129/302 (43%)
Tas 17..293 CDD:223739 123/282 (44%)
CG9436NP_610235.1 ARA1 3..298 CDD:223729 130/307 (42%)
Tas 6..282 CDD:223739 129/291 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468212
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
109.750

Return to query results.
Submit another query.