DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and gclm

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_009302077.1 Gene:gclm / 333974 ZFINID:ZDB-GENE-030131-5906 Length:274 Species:Danio rerio


Alignment Length:209 Identity:48/209 - (22%)
Similarity:82/209 - (39%) Gaps:44/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAA 135
            |:||.::.||:.|......:|.|.:.:..:|||..|:..::..|...:..|..|....|      
Zfish    85 REELKVSVKLFLTEWDCSSIRSAVDMACLSLGVSQLDSVIIAPPSLPEGESQTLTHLQP------ 143

  Fly   136 FEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLITL 200
                    .|:.:|:||......|||.|:.::..:.:|.:.|:      ||:  |..:|..|.:.
Zfish   144 --------LWQELESLVQSQKIAAIGTSDLDKTLLEQLYNWAQ------QIK--PSSNQVNLASC 192

  Fly   201 CYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQH--PTILAIAEKYERT---AAQVL------LRFQ 254
            |           .:....|.:.|.....||.|  |..|..|..::..   ::|.|      |.:.
Zfish   193 C-----------VMPPDLTAFAKEFDIQLLTHSDPKELISAAGFQEAVQGSSQELQVDDWRLEWV 246

  Fly   255 TQSGIIVIPRSVSK 268
            .:..|||..|.:.|
Zfish   247 LRYSIIVKSRGIIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 48/209 (23%)
Tas 17..293 CDD:223739 48/209 (23%)
gclmXP_009302077.1 Aldo_ket_red <85..255 CDD:294321 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.