DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c19

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001094046.1 Gene:Akr1c19 / 307096 RGDID:1562954 Length:323 Species:Rattus norvegicus


Alignment Length:314 Identity:120/314 - (38%)
Similarity:196/314 - (62%) Gaps:11/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEV----VTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68
            |::|..:|.||.||:: |.||    ..:|:..|::.|:||.|.|::|..|..||.|::.|:..|:
  Rat    10 LNDGHFIPALGFGTYK-PEEVPENKPLEAIHLAVEAGFRHIDTAYVYQTENHVGQAIKSKIAAGI 73

  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            |.|:::|||:|||.|.|:|::|..:.|.|::||.:.|::||::|:||..|||.| ::|. .:..|
  Rat    74 VKREDIFITTKLWCTFHRPEMVLSSLEKSLKNLQLDYVDLYIIHYPMQMKSGED-MFPE-DENGK 136

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKP 196
            ..|:.:|...||.|||...|.||.::|||||||.:|:.::|:.  .|.|||..|:|||.||:|..
  Rat   137 TLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVECHLYLNQSK 201

  Fly   197 LITLCYDNAIAVTAYSCLGSGHTP-YEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGII 260
            |:..|....|.:.||..|||.... :..|.:..||..|.:..:|:|::|::||:.||:|.|.|.:
  Rat   202 LLNYCKSRDIVLVAYCALGSQRPKRWVDPSSPVLLNDPVLCDVAKKHQRSSAQIALRYQLQRGNV 266

  Fly   261 VIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            |:.:|..:..:.:|. ::::|||..:|::.::.||.|.|:.......|||.:||
  Rat   267 VLAQSYKENEIKENI-QVFEFELPSEDMKILDSLDRNLRYAPAPFGQGHPEYPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 114/298 (38%)
Tas 17..293 CDD:223739 108/282 (38%)
Akr1c19NP_001094046.1 AKR_AKR1C1-35 6..308 CDD:381334 115/301 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.