DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1e2

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001008343.1 Gene:Akr1e2 / 307091 RGDID:1309599 Length:301 Species:Rattus norvegicus


Alignment Length:303 Identity:139/303 - (45%)
Similarity:200/303 - (66%) Gaps:11/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDELFITS 78
            :|.:|||||::.|..||.|||.||::||||||||::|.||::||..::||:.||||.||||||.|
  Rat     4 IPTVGLGTWKASPGEVTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEKIKEGVVKRDELFIVS 68

  Fly    79 KLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFEDIDYVD 143
            |||.|:||..||:.||..::..|.:.||:|||:||||.:|.|..::  ....:.|.......::|
  Rat    69 KLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWPMGFKPGDKDI--PLDRSGKVIPSHTSFLD 131

  Fly   144 TWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPLITLCYDNAI 206
            ||.|||:||.|||.:.|||||||.:|::|||:.  .::||:..||||||||:||.||..|:...:
  Rat   132 TWEAMEDLVIEGLVKNIGVSNFNHEQLDRLLNKPGLRIKPITNQIECHPYLNQKSLIDFCHGRNV 196

  Fly   207 AVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHM 271
            :||||..||.     .:.|.: |:....|..||:|:.::.||:|:|||.|..:||||:||:...:
  Rat   197 SVTAYRPLGG-----SRDGVH-LMDDIVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVNPSRI 255

  Fly   272 LDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .:|. :::||||...|::.:..||.|.|..|..:...|..:||
  Rat   256 RENI-QVFDFELTEKDMEELLSLDKNLRLATFPSTENHKDYPF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 134/287 (47%)
Tas 17..293 CDD:223739 130/277 (47%)
Akr1e2NP_001008343.1 Tas 4..287 CDD:223739 136/291 (47%)
ARA1 4..282 CDD:223729 134/286 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.