DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1b8

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_775159.1 Gene:Akr1b8 / 286921 RGDID:708475 Length:316 Species:Rattus norvegicus


Alignment Length:314 Identity:136/314 - (43%)
Similarity:194/314 - (61%) Gaps:13/314 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            ||....||::|||||:|.|..|.:|||.|||.||||.|||:.|.||.:||.|::||:.|..|.|:
  Rat     7 LSTKAKMPIVGLGTWKSMPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVRRE 71

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTN----K 133
            :|||.||||.|..:..|::.|.:.::.:|.:.||:|||:|||..:::|.: |:|.....|    |
  Rat    72 DLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGFQAGKE-LFPKDEQGNVLPSK 135

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKP 196
            ..|     ::.|..||.|||:||.:|:||||||..|:.|||:.  .|.|||..|:||||||:|:.
  Rat   136 TTF-----LEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEK 195

  Fly   197 LITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIV 261
            ||..|:...|.|||||.|||...|..||....|||.|.|..||.|:::|.||||:||..|..::|
  Rat   196 LIQYCHSKGIVVTAYSPLGSPDRPRAKPDDPSLLQDPKIKEIAAKHKKTTAQVLIRFHIQRNVVV 260

  Fly   262 IPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPFE 315
            ||:||:...:.:|. :::||:|:..::..|...:.|.|...:.........|::
  Rat   261 IPKSVTPARIQENI-QVFDFQLSDQEMATILSFNRNWRACLLPETVNMEEFPYD 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 134/297 (45%)
Tas 17..293 CDD:223739 129/281 (46%)
Akr1b8NP_775159.1 ARA1 1..297 CDD:223729 134/296 (45%)
Tas 16..289 CDD:223739 128/279 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.