DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c13

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus


Alignment Length:315 Identity:112/315 - (35%)
Similarity:192/315 - (60%) Gaps:11/315 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NFLLS--NGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEG 67
            ||:::  :|:...::.:..   |.....:|...|:|:||||.|.|:.|..|.::|.|::.|:..|
Mouse    12 NFIVNHYDGEKEDLVKINV---PKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAG 73

  Fly    68 VVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTN 132
            ||.|::||||:|||.|..:|:||:||.|.|::.|.:.|::||:||:|:..||| ||.:|. .:..
Mouse    74 VVKREDLFITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMKSG-DNDFPV-NEQG 136

  Fly   133 KAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQK 195
            |:..:.:|:.|||..:|...|.||.::|||||||.:|:.|:|:.  .|.|||..|:|||.||:|:
Mouse   137 KSLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQR 201

  Fly   196 PLITLCYDNAIAVTAYSCLGS-GHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGI 259
            .|:..|....|.:.||..||: .:..:....:..||..|.:..:|:|.:|:.|.:.||:..|.||
Mouse   202 KLLDYCESKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGI 266

  Fly   260 IVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            :.:.:|..:..|.:|. :::.|:|:.:|::.::.|:.|.|::..:....||.:||
Mouse   267 VPLAQSFKENEMRENL-QVFGFQLSPEDMKTLDGLNKNFRYLPAEFLVDHPEYPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 107/299 (36%)
Tas 17..293 CDD:223739 102/278 (37%)
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 105/284 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.