DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and SPAC2F3.05c

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_594384.1 Gene:SPAC2F3.05c / 2541958 PomBaseID:SPAC2F3.05c Length:275 Species:Schizosaccharomyces pombe


Alignment Length:290 Identity:93/290 - (32%)
Similarity:155/290 - (53%) Gaps:38/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |:||...|....|::.........:|..|:..||||.|.|.:|.|||..|.|:.:.|:|....|:
pombe     8 LNNGLKCPQFAYGSYMVNRTKCFDSVYAALQCGYRHIDSAQMYHNEADCGRAILKFMEETGTKRE 72

  Fly    73 ELFITSKLWN-THHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAF 136
            :::.||||.: :.:|..|  .:.:.|::..|:.|::|:|:|.|..                    
pombe    73 DIWFTSKLNDLSGYKSTL--SSIDASVKACGLGYIDLFLLHSPYG-------------------- 115

  Fly   137 EDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLL-SVAKLKPVVLQIECHPYLSQKPLITL 200
               |.:::|:|:|..|:||..:|||||||....:..|| |..|:.|.|.|||.||:.||:.::..
pombe   116 ---DRIESWKALEKGVEEGKLRAIGVSNFGPHHIQELLDSHPKIIPCVNQIELHPFCSQQKVVDY 177

  Fly   201 CYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRS 265
            |....|.:.||:.|..|    ||.|      :..:||||.||.::.||:::|:..|.|.||:|:|
pombe   178 CESKGIQLAAYAPLVHG----EKFG------NKQLLAIASKYNKSEAQIMIRYCLQRGFIVLPKS 232

  Fly   266 VSKQHMLDNFKRIWDFELAVDDIQAINELD 295
            .:.:.:.:| ..::|||::.:|::.:..||
pombe   233 STPRRIKEN-GDVFDFEISKEDMEKLYNLD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 93/290 (32%)
Tas 17..293 CDD:223739 87/277 (31%)
SPAC2F3.05cNP_594384.1 ARA1 1..274 CDD:223729 93/290 (32%)
Tas 9..272 CDD:223739 92/289 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.