DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and SPBC28F2.05c

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_595666.1 Gene:SPBC28F2.05c / 2540561 PomBaseID:SPBC28F2.05c Length:276 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:68/275 - (24%)
Similarity:125/275 - (45%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV-VTRDELFITSKLWNTHHKPDLVR--- 91
            |.|.:|:.:|.|..|.|..|.||.:...|:::...:.| :.|:::.:.:|:      ||.::   
pombe    28 QQVIEALSLGIRVIDSAITYRNEKECEQAIQDFCHQNVNIKREDITLITKI------PDSLQGFE 86

  Fly    92 ---PACETSIRNLGVKYLNLYLMH---WPMAYKSGSDNLYPTCPDTNKAAFEDIDYVDTWRAMEN 150
               .|.|.|:|..|...|::.|:|   ||                        :..:::|||:..
pombe    87 RTWKAVEQSLRRTGRPKLDVVLIHSPKWP------------------------VRRIESWRALLQ 127

  Fly   151 LVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLITLCYDNAIAVTAYSCLG 215
            ...||....|||||:|...:..::|:....|.:.|:|...:.::...::.|:::.|.|.|:|.|.
pombe   128 HQKEGRINKIGVSNYNIHHLEEIISLGLPLPAINQVEFSAFNNRPTFLSYCFNHGILVQAFSPLT 192

  Fly   216 SGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWD 280
            .|:.          |....:|.::.||.:|.|.:|||:..|.|:..|.::.|..|:.:|.| ...
pombe   193 RGYR----------LSDIRLLDLSLKYNKTPANILLRYCLQKGVSPIFKASSFVHIHENVK-AEQ 246

  Fly   281 FELAVDDIQAINELD 295
            |.|...|:..::..|
pombe   247 FMLDPSDMDVMDTWD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 68/275 (25%)
Tas 17..293 CDD:223739 67/271 (25%)
SPBC28F2.05cNP_595666.1 ARA1 1..276 CDD:223729 68/275 (25%)
Tas 9..258 CDD:223739 67/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.